PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_27873A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 386aa    MW: 42174.7 Da    PI: 7.1621
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_27873AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding249.3e-08314345132
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg 32 
                                +++W++  +++l ++v+++G+g+Wk I    +
  Oropetium_20150105_27873A 314 KKKWSKMQEKILQEGVEKYGKGNWKDIKMAYP 345
                                689***********************976655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-7311356IPR009057Homeodomain-like
SuperFamilySSF466894.6E-7313353IPR009057Homeodomain-like
PfamPF002491.4E-5314345IPR001005SANT/Myb domain
CDDcd116603.29E-10315354No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MTFSPAHTPS RIGTGGTATQ GNATPPMATA AFLVLEFVAG NGRIPHSVFA ALLAALPLPF  60
PRDSPRLRKA LALRALDAAL HHEDAASTAL LLLRKARVIL ADPDMASCFP QPLVFSLLDD  120
KDDDEVTAAA AMADLKRILD HEWASLPLST LEIAADRLAG AGALEMWARA DGSKRRKLRL  180
LVGDSIEREI VTKLGQDAYD RTSGNETDHV QGDGEADLST ENNESEYAQV THAQPQHESI  240
KGAGKGKVLD TPLVMDTSTF HVPEQSAPGN AESHRFAACN LNPMHSDDER PLRHRRLPPF  300
ERKPKPSTVS QTTKKKWSKM QEKILQEGVE KYGKGNWKDI KMAYPGIFED RSTVCRFEGQ  360
VQKYGKTSIY VRPAYLSSSG TWESN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958819.11e-101PREDICTED: telomeric repeat-binding factor 2-like
TrEMBLA0A0A9S1H91e-113A0A0A9S1H9_ARUDO; Uncharacterized protein
STRINGSi030461m2e-98(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139982224
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G15720.12e-07TRF-like 5